General Information

  • ID:  hor000087
  • Uniprot ID:  P32005
  • Protein name:  Oxytocin
  • Gene name:  OXT
  • Organism:  Papio hamadryas (Hamadryas baboon)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Papio (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PLG
  • Length:  3
  • Propeptide:  PLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVFGLCCSPDGC
  • Signal peptide:  NA
  • Modification:  T3 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cause contraction of the smooth muscle of the uterus and of the mammary gland
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 20 (t1/2 elimination) minute; /1200 seconds ( PubMed ID: 6121002 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P32005-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000087_AF2.pdbhor000087_ESM.pdb

Physical Information

Mass: 32120 Formula: C13H23N3O4
Absent amino acids: ACDEFHIKMNQRSTVWY Common amino acids: GLP
pI: 6.11 Basic residues: 0
Polar residues: 1 Hydrophobic residues: 1
Hydrophobicity: 60 Boman Index: 586
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 130
Instability Index: 666.67 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  2249637##6121002
  • Title:  Expression of the Oxytocin and Vasopressin Genes in Human and Baboon Gonadal Tissues